PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TCP
Protein Properties Length: 391aa    MW: 43196.7 Da    PI: 10.1177
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48751.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.41.8e-2859135379
         TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesss 79 
                 g kdrhsk++T +g+RdRR+Rls+++a++++ Lqd+LGf ++sk ++WLl++ k  i++l+ +++++  + + +++ 
  KHN48751.1  59 GSKDRHSKVCTIRGLRDRRIRLSVPTAIQLYNLQDKLGFNQPSKVVDWLLEATKSDIDKLPPLQFPHCFAHQFHQQT 135
                 68*************************************************************66655222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.87560118IPR017887Transcription factor TCP subgroup
PfamPF036341.2E-2760155IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MMIESSGKVH EAKNQQEGDD DNNIKIEKLL KARPSTSSSS RSWSAFRNPR IVRVSRSLGS  60
KDRHSKVCTI RGLRDRRIRL SVPTAIQLYN LQDKLGFNQP SKVVDWLLEA TKSDIDKLPP  120
LQFPHCFAHQ FHQQTLLPGT SQFSLGGFYD AANNNSTFIK DGGNQNRLTA TKSTRYWDID  180
SLNNGKELAE SVSISQKGQF WIKTNEQENH QGGGIGGSST TTHNREDNSS VHYKLFPIGT  240
TTNNSYLPGL LNNGMTHNSY HHSEPSRLSL SHFGSHGLFP SHDSHQSSGI GVPFSSSNFS  300
GASSGPQLLF CPTSATPSAF YSVESDPRQS NNNVQIFSSS SQVMKRLPLI QSLHSTNSPI  360
SRRLPTSFSS KLLDSDNNDR SQPNKGTSSR S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579501.10.0PREDICTED: transcription factor TCP5-like
RefseqXP_006579500.10.0PREDICTED: transcription factor TCP5-like
RefseqXP_006579499.10.0PREDICTED: transcription factor TCP5-like
SwissprotQ9FME35e-48TCP5_ARATH; Transcription factor TCP5
TrEMBLA0A0B2SQ610.0A0A0B2SQ61_GLYSO; Transcription factor TCP5
TrEMBLK7KME00.0K7KME0_SOYBN; Uncharacterized protein
STRINGGLYMA05G00300.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-47TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]